Protein Info for DZA65_RS19475 in Dickeya dianthicola ME23

Annotation: threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 PF14821: Thr_synth_N" amino acids 7 to 80 (74 residues), 40.7 bits, see alignment E=3.1e-14 TIGR00260: threonine synthase" amino acids 53 to 395 (343 residues), 386.3 bits, see alignment E=6.5e-120 PF00291: PALP" amino acids 96 to 364 (269 residues), 78.4 bits, see alignment E=9.2e-26 PF24857: THR4_C" amino acids 357 to 403 (47 residues), 28.3 bits, see alignment 2.4e-10

Best Hits

Swiss-Prot: 83% identical to THRC_SERMA: Threonine synthase (thrC) from Serratia marcescens

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 97% identity to dze:Dd1591_0535)

MetaCyc: 80% identical to threonine synthase (Escherichia coli K-12 substr. MG1655)
Threonine synthase. [EC: 4.2.3.1]

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1S6 at UniProt or InterPro

Protein Sequence (429 amino acids)

>DZA65_RS19475 threonine synthase (Dickeya dianthicola ME23)
MKLYNLKDHNEQVNFAEAIRKGLGSNQGLFFPLDLPEFDRTTIDELLEQDFVTRSSRILS
AFIGDEMSDETIYQRVKAAFRFPAPVVPVSEDIAALELFHGPTLAFKDFGGRLMAQMLAE
VAGDQQITILTATSGDTGAAVAHAFYGLKNVRVVILYPNGKISPLQEKLFCTLGGNIHTI
AIDSDFDACQALVKQAFDDEELKRAIGLNSANSINISRLLAQISYYFEAVAQLPQDARNQ
LVVSVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLQSGAWQPNPTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKELAFGAVSDETTKATMQELDALGYTSEPHAAIAYRL
LRDQLQPDEYGLFLGTAHPAKFKESVEAILAKALPLPAALAERADLALLSHYFAPDFAQL
RKFLMELPH