Protein Info for DZA65_RS19450 in Dickeya dianthicola ME23

Annotation: acetate uptake transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 190 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 150 to 169 (20 residues), see Phobius details PF01184: Gpr1_Fun34_YaaH" amino acids 3 to 177 (175 residues), 143.2 bits, see alignment E=4.4e-46

Best Hits

Swiss-Prot: 80% identical to SATP_ECOLI: Succinate-acetate/proton symporter SatP (satP) from Escherichia coli (strain K12)

KEGG orthology group: K07034, (no description) (inferred from 97% identity to dze:Dd1591_0541)

MetaCyc: 80% identical to acetate/succinate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN0-571

Predicted SEED Role

"YaaH protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1W0 at UniProt or InterPro

Protein Sequence (190 amino acids)

>DZA65_RS19450 acetate uptake transporter (Dickeya dianthicola ME23)
MHAKTLANPGPLGLMGFGMTTILLNLHNAGFFPLTSIILSMGIFYGGIAQILAGLLEYKK
GNTFGVTAFTSYGAFWLTLVAIIMLPKMGLAEAADAQFLGVFLALWGVFTLFMFFGTLGA
NRALQFVFASLTVLFALLAIGNIIGNHTLLTFAGYEGIICGASAIYLAMAEVLNEQYGRT
VLPIGARGAH