Protein Info for DZA65_RS19375 in Dickeya dianthicola ME23

Annotation: LysE family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 63 (26 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 118 to 139 (22 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 185 to 203 (19 residues), see Phobius details PF01810: LysE" amino acids 15 to 203 (189 residues), 125.1 bits, see alignment E=1.2e-40

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_01388)

Predicted SEED Role

"Threonine efflux protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y257 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DZA65_RS19375 LysE family transporter (Dickeya dianthicola ME23)
MLETSLFVATIAALGMISPGPDFFLVIKNAVRYPRLAAMMTAVGVIAGVATHMAYCVAGL
AVVITTTPWLFSLLKYVGAAYLIWLGIQALRSRGGSQLDLSGLAPQRVGLWKAFIQGYLC
NLLNPKATLFFLAVFTQVLGLNSSVGEKLWYAGIIWGLTLIWWPLLVILIQSEPVRRGLT
KAQKLIDKLLGGVLITLGIKVALS