Protein Info for DZA65_RS19215 in Dickeya dianthicola ME23

Annotation: 3-isopropylmalate dehydratase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF00694: Aconitase_C" amino acids 1 to 125 (125 residues), 145.6 bits, see alignment E=1.7e-46 TIGR00171: 3-isopropylmalate dehydratase, small subunit" amino acids 1 to 188 (188 residues), 326.4 bits, see alignment E=2.8e-102 PF27512: LeuD" amino acids 129 to 165 (37 residues), 46.3 bits, see alignment 4.3e-16 PF27434: LeuD_C" amino acids 178 to 197 (20 residues), 28.3 bits, see alignment (E = 1.4e-10)

Best Hits

Swiss-Prot: 87% identical to LEUD_SERP5: 3-isopropylmalate dehydratase small subunit (leuD) from Serratia proteamaculans (strain 568)

KEGG orthology group: K01704, 3-isopropylmalate/(R)-2-methylmalate dehydratase small subunit [EC: 4.2.1.33 4.2.1.35] (inferred from 96% identity to ddd:Dda3937_01353)

MetaCyc: 82% identical to 3-isopropylmalate dehydratase subunit LeuD (Escherichia coli K-12 substr. MG1655)
3-isopropylmalate dehydratase. [EC: 4.2.1.33]

Predicted SEED Role

"3-isopropylmalate dehydratase small subunit (EC 4.2.1.33)" in subsystem Branched-Chain Amino Acid Biosynthesis or Leucine Biosynthesis (EC 4.2.1.33)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.33, 4.2.1.35

Use Curated BLAST to search for 4.2.1.33 or 4.2.1.35

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4DGN1 at UniProt or InterPro

Protein Sequence (200 amino acids)

>DZA65_RS19215 3-isopropylmalate dehydratase small subunit (Dickeya dianthicola ME23)
MAKFTQHTGLVVPLDIANVDTDAIIPKQFLQKVTRTGFGQHLFNDWRFLDDAGQQPNPDF
VLNQPRYKGASILLARENFGCGSSREHAPWALTDYGFNVVIAPSFADIFYGNAFNNQLLP
VKLSESDIDDLFKLVASREGITFTVDLEAQQVKAGDNTYSFEIDSFRRHCMINGLDSIGL
TLQHDAAISRYEQQQPAFLR