Protein Info for DZA65_RS19125 in Dickeya dianthicola ME23

Annotation: cell division protein FtsW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 72 to 90 (19 residues), see Phobius details amino acids 96 to 117 (22 residues), see Phobius details amino acids 160 to 179 (20 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 208 to 228 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 326 to 350 (25 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details TIGR02614: cell division protein FtsW" amino acids 31 to 386 (356 residues), 447.5 bits, see alignment E=1.7e-138 PF01098: FTSW_RODA_SPOVE" amino acids 33 to 388 (356 residues), 423.5 bits, see alignment E=3.2e-131

Best Hits

Swiss-Prot: 82% identical to FTSW_ECOL6: Probable peptidoglycan glycosyltransferase FtsW (ftsW) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03588, cell division protein FtsW (inferred from 98% identity to ddc:Dd586_3533)

MetaCyc: 82% identical to peptidoglycan glycosyltransferase FtsW (Escherichia coli K-12 substr. MG1655)
Peptidoglycan glycosyltransferase. [EC: 2.4.1.129]

Predicted SEED Role

"Cell division protein FtsW" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.1.129

Use Curated BLAST to search for 2.4.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1P6 at UniProt or InterPro

Protein Sequence (400 amino acids)

>DZA65_RS19125 cell division protein FtsW (Dickeya dianthicola ME23)
MRVIGAGMVERLKSWVMGTRESDTLSTVLYDRTLLWLTLGLAVIGFVMVTSASMPIGQRL
ASDPFLFAKRDALYLGLAFGLSLVTMRVPMEVWQRYSVVLLLVSIVMLLIVLAVGSSVNG
ASRWISLGPLRIQPAELSKLSLFCYLSSYMVRKVDEVRNNFWGFCKPMGVMVVLAVLLLA
QPDLGTVVVLFITTLAMLFLAGAKLWQFLAIISCGVFAVALLIIAEPYRVRRVTSFWNPW
DDPFGSGYQLTQSLMAFGRGELWGQGLGNSIQKLEYLPEAHTDFIFSILGEELGYIGVVL
ALLMIFFVAFRAMSIGRRALEIDQRFSGFLACSIGIWFSFQTLVNVGAAAGMLPTKGLTL
PLISYGGSSLLIMSTAIVLLLRIDYETRLTKAQAFTRGAR