Protein Info for DZA65_RS18940 in Dickeya dianthicola ME23

Annotation: sodium:solute symporter family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 473 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 47 to 65 (19 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 123 to 147 (25 residues), see Phobius details amino acids 153 to 172 (20 residues), see Phobius details amino acids 179 to 201 (23 residues), see Phobius details amino acids 228 to 251 (24 residues), see Phobius details amino acids 264 to 288 (25 residues), see Phobius details amino acids 308 to 337 (30 residues), see Phobius details amino acids 358 to 374 (17 residues), see Phobius details amino acids 386 to 403 (18 residues), see Phobius details amino acids 410 to 428 (19 residues), see Phobius details amino acids 434 to 453 (20 residues), see Phobius details PF00474: SSF" amino acids 39 to 379 (341 residues), 91.5 bits, see alignment E=2.8e-30

Best Hits

KEGG orthology group: K03307, solute:Na+ symporter, SSS family (inferred from 95% identity to dze:Dd1591_0645)

Predicted SEED Role

"Acetate permease ActP (cation/acetate symporter)" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CU60 at UniProt or InterPro

Protein Sequence (473 amino acids)

>DZA65_RS18940 sodium:solute symporter family protein (Dickeya dianthicola ME23)
MNHFDLTDTLIIVGMIVFYIAFTSWLTLKLRSNSSAEFMEGSRSLPAFIVGVLLMTEFIG
AKSTVGTAQAAFESGIAASWSVIGAAIGFLLFGMILVKKIYNTGQVTISAAIAERYGTST
KNIISIIMIYALLLVNVGNYVSGAAAIATVLKISLPVAALITAIVSTFYFYFGGLKGVAY
VTLIHSGLKYIGVMIILYVALKMTGGITPMVENMPSYYWTWDGNIGASTIVAWLIGTIGS
IFCTQFVIQAISATKDAASAKRATWIAFFFCMPIALAIAVIGVAAKFVHPEIKSLYAMPV
FLQDMNPWLAGLVTTSLVASIFISVSTVALAIASLIVKDFYVPYYKPTPEKEMKMTRVFS
LIIGFLPLIFVLLVPEVLKLSFFTRAIRLSISVVAMIAFYLPFFNSARGANASLISACVA
TSVWYVLGNPYGIDNMYVALVTPAAVMVLDRLIPNNGAKAKQQTESSVPHSGA