Protein Info for DZA65_RS18865 in Dickeya dianthicola ME23

Annotation: sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 PF00005: ABC_tran" amino acids 20 to 161 (142 residues), 111.5 bits, see alignment E=7.7e-36 PF17912: OB_MalK" amino acids 235 to 284 (50 residues), 39.8 bits, see alignment 1e-13 PF08402: TOBE_2" amino acids 278 to 350 (73 residues), 36.1 bits, see alignment E=8.5e-13

Best Hits

Swiss-Prot: 51% identical to UGPC_SHIBS: sn-glycerol-3-phosphate import ATP-binding protein UgpC (ugpC) from Shigella boydii serotype 4 (strain Sb227)

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 96% identity to ddd:Dda3937_03079)

MetaCyc: 50% identical to sn-glycerol 3-phosphate ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-34-RXN [EC: 7.6.2.10]; 7.6.2.10 [EC: 7.6.2.10]

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1D9 at UniProt or InterPro

Protein Sequence (366 amino acids)

>DZA65_RS18865 sn-glycerol-3-phosphate ABC transporter ATP-binding protein UgpC (Dickeya dianthicola ME23)
MASLELKNVHKNYGSIQIIKGVDLIIRDGEFMVFVGPSGCGKSTLLRMIAGLEPITDGEL
WIGDRKVNSLGPAERKIAMVFQSYALYPHLSVRKNLAFGLENLHFPKDEIERRIGEAARM
LGLEPYLERKPRALSGGQQQRVAIGRAIVRDPDLFLFDEPLSNLDAKLRVQTRGELTRLH
QKLRTTMIYVTHDQVEAMTMAQRIVVLNGGRIEQVGTPLELFNRPKNKFVAGFIGSPRMN
MFHATISSASDDGVDVRCPSGNLLRLPFRGEEGKTVALGIRPSHCQLVSEHDDGVSLCID
RCEMMGHETFIYGRCGGIEDELIVHLPGHHEFRAGELVFVRFPQDYCHLFDADSGQSLPR
LTERDA