Protein Info for DZA65_RS18795 in Dickeya dianthicola ME23

Annotation: type VI secretion system tip protein VgrG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 596 TIGR01646: Rhs element Vgr protein" amino acids 30 to 495 (466 residues), 189.4 bits, see alignment E=6.3e-60 PF05954: Phage_GPD" amino acids 70 to 339 (270 residues), 35.1 bits, see alignment E=9.1e-13 PF04717: Phage_base_V" amino acids 377 to 451 (75 residues), 79.8 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_03066)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1U0 at UniProt or InterPro

Protein Sequence (596 amino acids)

>DZA65_RS18795 type VI secretion system tip protein VgrG (Dickeya dianthicola ME23)
MADSPAAHSDGVVTCTIRSNGAEIGNDIQLLSLQVCKRVNHIARAELVMMDGDMPQNRFP
LSSGSLFKPGNSLTIAAGYASQEQLLFDGIIIRHGISIGGGGHSRLVIECRDNAIGMTVA
RRNDNYLKQKDSDILSRLISRCAGVSARVDTTHTQHDELVQFNCTDWDFLLARAEANGLV
VCNDDNTVAVTAPTLNASPVLTVTYGDDLISLTADIDARHQFTSVTGVGWDIKNQQPLQE
KAAAQSVSRQGNLSADELAQVLGLTEYRLQSATPLAGTALRDWARGQQVKSALSRLRGTL
TCQGCARARINTLITLAGVGARFNGHLYVSGVRHHIQDGQWLTHIDFGMPPVWSAEHRDL
TPPPAAGLLPGVDGLQIGIVKKLDGDPQQQHRVQVSVPVMQAENDGVWARLASYYASTGI
GAQFMPEVGDEVVLGYFNNNPSDPVILGSLYSSKNPPPVTPDAKNTLKTLMTRSQLTLQF
NEEDKAITLTTPGGNQAVLSDKGKTVTLQDQNGNRVTLDSSGITLDSPKNITLNAKGKIE
LTAGRAINISAKANVTAEGMNVSLSAKTGLTAKGNATAELSASGQTVVKGGIVMIN