Protein Info for DZA65_RS18770 in Dickeya dianthicola ME23

Annotation: phage tail sheath family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 PF17482: Phage_sheath_1C" amino acids 408 to 511 (104 residues), 36.8 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: K06907, (no description) (inferred from 97% identity to ddd:Dda3937_03061)

Predicted SEED Role

"Phage tail sheath protein FI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C8U4 at UniProt or InterPro

Protein Sequence (517 amino acids)

>DZA65_RS18770 phage tail sheath family protein (Dickeya dianthicola ME23)
MGVMKTPGVYIVEKNAFPNSVVEVATAVPAFIGYTEKAENGGVSLRNKAWRITSMSDFRH
YFGGAPLHKFDLVEKTDTVLGDAAFSQAGKTYALTQANTRYLLYYSMLFFFQNGGGPCYI
ISVGGYQDATDAGALKNGITPLLKEPEPTMVLTPEAVCLKEDDCINVQQAVLAHCGGTMK
NRVAILDVWEGYKDRQDPSGDCIATFRSKLGINYLDYATAYYPWLNTSIIQDSEISFANI
NNLDILTTVLNAEIAAAFKELDGLSAEQLNSGGNKLKAAKKQQMLDEVARLSVEQSEAEK
TLLHKILFSISPIYKSVLENIRRQQNLLPPAASMAGIYTMVDNARGVWKAPANVSLNAVI
SPSVNISADEQEDLNVTTQGKSINALRTFTGEGTLVWGARTLDGNSLDWRYVNVRRTMIM
LEESIKQAAKAYVFEPNTANTWVSMESMIENFLFGIWKRGGLAGASPEDAYSVDVGLGKT
MTPQDILEGILRITVLVAISRPAEFIEITFQQQMQKS