Protein Info for DZA65_RS18715 in Dickeya dianthicola ME23

Annotation: type I-F CRISPR-associated endonuclease Cas1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 232 to 254 (23 residues), see Phobius details TIGR03637: CRISPR-associated endonuclease Cas1, subtype I-F/YPEST" amino acids 13 to 319 (307 residues), 512.1 bits, see alignment E=5.4e-158 TIGR00287: CRISPR-associated endonuclease Cas1" amino acids 20 to 320 (301 residues), 224.5 bits, see alignment E=1.8e-70 PF01867: Cas_Cas1" amino acids 39 to 273 (235 residues), 39.8 bits, see alignment E=1.7e-14

Best Hits

Swiss-Prot: 90% identical to CAS1_PECAS: CRISPR-associated endonuclease Cas1 (cas1) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 96% identity to dda:Dd703_0734)

Predicted SEED Role

"CRISPR-associated protein Cas1" in subsystem CRISPRs

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y218 at UniProt or InterPro

Protein Sequence (333 amino acids)

>DZA65_RS18715 type I-F CRISPR-associated endonuclease Cas1 (Dickeya dianthicola ME23)
MDNVFSPSDLKTILHSKRANIYYLQHCRILVNGGRVEYVTEEGNQSLYWNIPIANTSVVM
LGTGTSVTQAAMREFARAGVMVGFCGGGGTPLFAANEAEVAVSWLSPQSEYRPTGYLQDW
VSFWFHEEQRLAAAIAFQQARIGQIRLHWLGGRLSRESRFTIKPEHVEALLNRYQQGLAN
CRTSNDVLVQEAMMTKALYRLAANAVSYGEFTRAKRGGGTDLANRFLDHGNYLAYGLAAV
ALWVLGLPHGLAVLHGKTRRGGLVFDVADLIKDALILPQAFIAAMEGEDEQEFRQRCLTS
FRQAEALDVMIDSLQQVAQQRSQVAKTGSQEAQ