Protein Info for DZA65_RS18675 in Dickeya dianthicola ME23

Annotation: YitT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 50 to 75 (26 residues), see Phobius details amino acids 81 to 105 (25 residues), see Phobius details amino acids 112 to 131 (20 residues), see Phobius details amino acids 164 to 193 (30 residues), see Phobius details PF02588: YitT_membrane" amino acids 18 to 193 (176 residues), 109.7 bits, see alignment E=1.3e-35 PF19700: DUF6198" amino acids 18 to 177 (160 residues), 37.9 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 95% identity to ddc:Dd586_3439)

Predicted SEED Role

"Transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CDD6 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DZA65_RS18675 YitT family protein (Dickeya dianthicola ME23)
MDNVITPQPVSHTLLEDVLALLIGTLMVSFGVIMLRQAGALTGGTAGMAFLLHYATRISF
GTAFFLLNLPFYYLAIRRMGWAFTVKTFCAVAMVSLFSDLHPLFIHFDHLQPIYATLFGN
LIMGLGFIVLFRHRASLGGMNILALYLQDKSGIRAGKLQMAVDVAIVLTSLFVVSISMLI
ASVLGAAALNLIIAMNHRPGRYTA