Protein Info for DZA65_RS18650 in Dickeya dianthicola ME23

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 79% identical to ALR_PECCP: Alanine racemase (alr) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 94% identity to ddd:Dda3937_03446)

MetaCyc: 66% identical to alanine racemase 1 (Escherichia coli K-12 substr. MG1655)
Alanine racemase. [EC: 5.1.1.1, 5.1.1.10]

Predicted SEED Role

"Alanine racemase, biosynthetic (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

L-alanine degradation I (2/2 steps found)
alanine racemization (1/1 steps found)
anaerobic energy metabolism (invertebrates, cytosol) (5/7 steps found)
superpathway of anaerobic energy metabolism (invertebrates) (10/17 steps found)
L-arginine degradation XIV (oxidative Stickland reaction) (2/6 steps found)
L-lysine degradation V (3/9 steps found)
ansatrienin biosynthesis (1/9 steps found)
cyclosporin A biosynthesis (2/15 steps found)
superpathway of L-lysine degradation (11/43 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1 or 5.1.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CE36 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DZA65_RS18650 alanine racemase (Dickeya dianthicola ME23)
MKTATAVIDRQALRHNLQRIRQMAPQSRLIAIVKANAYGHGAVEAARAFSDADGYGVSRL
SEALALRAAGITKPILLLEGFFAADELPLLAEHQLETAVHSEEQLAALEQAHLAHPLTVW
MKLDTGMHRLGVLPEKADAFYARLSACSSVAQPVNIMSHFCRADEPQAGATQRQLDCFDA
FVQDKPGRQSIAASGGILLWPQTHRDQIRPGIIQYGVSPLAQGDASQWQLKPAMTLTSHL
IAVREHHTGEPVGYGSSWSSPHDTRLGVIAIGYGDGYPRDAKSGTPVWINGREVPLSGRV
SMDMITVDLGPNAQDNVGDEVILWGGPLPVEKVAAYNGISAYELITRLTSRTQLEYIG