Protein Info for DZA65_RS18590 in Dickeya dianthicola ME23

Annotation: UTRA domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00392: GntR" amino acids 9 to 69 (61 residues), 55.4 bits, see alignment E=3.9e-19 PF07702: UTRA" amino acids 91 to 227 (137 residues), 125.2 bits, see alignment E=1.8e-40

Best Hits

Swiss-Prot: 44% identical to PHNR_SALCH: Putative transcriptional regulator of 2-aminoethylphosphonate degradation operons (phnR) from Salmonella choleraesuis (strain SC-B67)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_04081)

Predicted SEED Role

"2-aminoethylphosphonate uptake and metabolism regulator" in subsystem Phosphonate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y194 at UniProt or InterPro

Protein Sequence (234 amino acids)

>DZA65_RS18590 UTRA domain-containing protein (Dickeya dianthicola ME23)
MNRQPTAVAQIADALIDRMRQGEFAGGRLPSERALSEQFSTTRITLREALTLLESQGIIY
RELRRGWFISPPRLSYNPLHRSHFHEMAEKQGRKATTEVLDAGVIAVNATIARHLELEED
AEIYRIRRLRRLDGRAVLYVEHYLNPAWFPDLLNSDLTRSLTQLYQSQYDIRYGRVRFTM
LPTPLPPVAAPVLKLAPGSPALFITRINRDQHDRIIDCDYEYWRYDALYIDVEA