Protein Info for DZA65_RS18575 in Dickeya dianthicola ME23

Annotation: ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 66 to 85 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 148 to 167 (20 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 249 to 271 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 87 to 273 (187 residues), 34.7 bits, see alignment E=7.9e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_04078)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1P9 at UniProt or InterPro

Protein Sequence (280 amino acids)

>DZA65_RS18575 ABC transporter permease subunit (Dickeya dianthicola ME23)
MRSRWLAALVLLPFFAVFIAFQIAPLVWMAINSFYSEMDSAWGLANYRDLLTSPFYLQAM
RFSLDISFWSSLYGLFIALVGGYSLQQLGEGRLRRFVMSFANMTSNFAGVPLAFAFVIML
GLNGFITLLLKQNGLIDGFNLYSRDGLILIYTYFQIPLGILLLYPAFDGLRSEWQESALL
LGASRWRYWLHIGIPVLTPALLGTFVILLANALGAYATIYALTTGNFNVVPVRIAALVSG
DISLDPNLGSALAMLLVLLMALITVAHQWLLRRSYLHAAR