Protein Info for DZA65_RS18465 in Dickeya dianthicola ME23

Annotation: entericidin A/B family lipoprotein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 42 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF08085: Entericidin" amino acids 22 to 41 (20 residues), 30.1 bits, see alignment E=1.8e-11

Best Hits

Swiss-Prot: 57% identical to ECNA_ECO57: Entericidin A (ecnA) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 86% identity to ddd:Dda3937_02595)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (42 amino acids)

>DZA65_RS18465 entericidin A/B family lipoprotein (Dickeya dianthicola ME23)
MKTSTLLIATLLMASTLSGCNTARGFGQDVQKLGSSISHTAS