Protein Info for DZA65_RS18445 in Dickeya dianthicola ME23

Annotation: YggT family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 61 to 86 (26 residues), see Phobius details amino acids 93 to 119 (27 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details PF02325: CCB3_YggT" amino acids 1 to 82 (82 residues), 73.2 bits, see alignment E=8.7e-25 amino acids 99 to 172 (74 residues), 76.1 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 55% identical to YPI3_VIBAL: Uncharacterized protein in proC 3'region from Vibrio alginolyticus

KEGG orthology group: K02221, YggT family protein (inferred from 98% identity to dze:Dd1591_0758)

Predicted SEED Role

"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CB11 at UniProt or InterPro

Protein Sequence (184 amino acids)

>DZA65_RS18445 YggT family protein (Dickeya dianthicola ME23)
MLTLTFLVKTLIDLYVMVLLLRIWMQWARSDFYNPLAQFVVKLTQPIIGPLRRIIPSLGP
VDSASLLLAFLLTTLKYPLLLLIQVGSLSLSPINLLVGLLALVKSAGYLVFWIVIIRSLM
SWVSQGRSPVDYMLHQLTEPLMGPLRRILPSAGGLDFSPMVVILVLYLLNYLGMDFFPGL
WFLL