Protein Info for DZA65_RS18445 in Dickeya dianthicola ME23
Annotation: YggT family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 55% identical to YPI3_VIBAL: Uncharacterized protein in proC 3'region from Vibrio alginolyticus
KEGG orthology group: K02221, YggT family protein (inferred from 98% identity to dze:Dd1591_0758)Predicted SEED Role
"Integral membrane protein YggT, involved in response to extracytoplasmic stress (osmotic shock)" in subsystem Phosphate metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CB11 at UniProt or InterPro
Protein Sequence (184 amino acids)
>DZA65_RS18445 YggT family protein (Dickeya dianthicola ME23) MLTLTFLVKTLIDLYVMVLLLRIWMQWARSDFYNPLAQFVVKLTQPIIGPLRRIIPSLGP VDSASLLLAFLLTTLKYPLLLLIQVGSLSLSPINLLVGLLALVKSAGYLVFWIVIIRSLM SWVSQGRSPVDYMLHQLTEPLMGPLRRILPSAGGLDFSPMVVILVLYLLNYLGMDFFPGL WFLL