Protein Info for DZA65_RS18380 in Dickeya dianthicola ME23

Annotation: esterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 PF01738: DLH" amino acids 26 to 227 (202 residues), 42.3 bits, see alignment E=2.9e-14 PF12146: Hydrolase_4" amino acids 27 to 133 (107 residues), 40.8 bits, see alignment E=7.4e-14 PF00561: Abhydrolase_1" amino acids 28 to 129 (102 residues), 36.2 bits, see alignment E=2.5e-12 PF12697: Abhydrolase_6" amino acids 30 to 236 (207 residues), 35.1 bits, see alignment E=1e-11 PF00326: Peptidase_S9" amino acids 94 to 234 (141 residues), 57 bits, see alignment E=8.8e-19 PF08840: BAAT_C" amino acids 95 to 235 (141 residues), 22.7 bits, see alignment E=4.3e-08

Best Hits

KEGG orthology group: K06889, (no description) (inferred from 94% identity to ddd:Dda3937_02615)

Predicted SEED Role

"YjfP protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y577 at UniProt or InterPro

Protein Sequence (249 amino acids)

>DZA65_RS18380 esterase (Dickeya dianthicola ME23)
MVEMGSENVSGIDVLHAFPSGGGTRPLPTIFFFHGYTSSKEVYAYFAYALAKAGFRVIAP
DALMHGARFDGDEARRWRCFWDIFLNNVQELPVHLNWCRERGLIDGDRVGICGASMGGMT
ALAAMTQYPWLRAVACFMGSGYFSSLSQTLFPPVTSEEPGAQAQLQALAERVAPFDVRHQ
LDKVSDRPLLLWHGLADELVPAQESERLYRELSARQSHQRLTYLTEAGIGHKITPTALRA
SADFFSRSL