Protein Info for DZA65_RS18370 in Dickeya dianthicola ME23
Annotation: primosomal replication protein N
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 91% identical to PRIB_PECCP: Primosomal replication protein N (priB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)
KEGG orthology group: K02686, primosomal replication protein N (inferred from 96% identity to dze:Dd1591_0775)MetaCyc: 82% identical to primosomal replication protein N (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Primosomal replication protein N" in subsystem DNA-replication
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4D932 at UniProt or InterPro
Protein Sequence (106 amino acids)
>DZA65_RS18370 primosomal replication protein N (Dickeya dianthicola ME23) MVTANRLELSGTVCKTPIRKVSPSGIPHCQFVLEHRSVQEEAGLSRQAWCRMPVIVSGHP SQAFTHSITVGMQLRVQGFISCHQGRNGLSKVVLHAEQIELIDSGD