Protein Info for DZA65_RS18165 in Dickeya dianthicola ME23

Annotation: 2-hydroxy-3-oxopropionate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 294 PF03446: NAD_binding_2" amino acids 2 to 161 (160 residues), 182.5 bits, see alignment E=1.3e-57 PF02826: 2-Hacid_dh_C" amino acids 2 to 115 (114 residues), 26.8 bits, see alignment E=6.2e-10 TIGR01505: 2-hydroxy-3-oxopropionate reductase" amino acids 2 to 292 (291 residues), 483.1 bits, see alignment E=1.4e-149 PF03807: F420_oxidored" amino acids 2 to 94 (93 residues), 32.4 bits, see alignment E=2.4e-11 PF14833: NAD_binding_11" amino acids 164 to 282 (119 residues), 140.3 bits, see alignment E=7.6e-45

Best Hits

Swiss-Prot: 87% identical to GARR_ECOLI: 2-hydroxy-3-oxopropionate reductase (garR) from Escherichia coli (strain K12)

KEGG orthology group: K00042, 2-hydroxy-3-oxopropionate reductase [EC: 1.1.1.60] (inferred from 97% identity to ddd:Dda3937_00191)

MetaCyc: 87% identical to tartronate semialdehyde reductase (Escherichia coli K-12 substr. MG1655)
2-hydroxy-3-oxopropionate reductase. [EC: 1.1.1.60]

Predicted SEED Role

"2-hydroxy-3-oxopropionate reductase (EC 1.1.1.60)" in subsystem Allantoin Utilization or D-galactarate, D-glucarate and D-glycerate catabolism or Photorespiration (oxidative C2 cycle) (EC 1.1.1.60)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.60

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4E4 at UniProt or InterPro

Protein Sequence (294 amino acids)

>DZA65_RS18165 2-hydroxy-3-oxopropionate reductase (Dickeya dianthicola ME23)
MKIGFIGLGIMGKPMSKNLIKAGYSLVVLDRNSAAVAEVVAAGATSAETPKAVAEQSDIV
ITMLPNSPHVKEVVLGENGVIEGARKGTAVIDMSSIAPLASREIAAALAEKGVDMLDAPV
SGGEPKAIDGTLSVMVGGDKALFDRSYAVMKAMAGSVVHTGDIGAGNVTKLANQVIVALN
IAAMSEALVLATKAGVNPDLVYQAIRGGLAGSTVLDAKAPMVMDRNFKPGFRIDLHIKDL
ANALDTSHGVGAQLPLTAAVMEMMQALKADELGGADHSALACYYEKLAKVEVTR