Protein Info for DZA65_RS18035 in Dickeya dianthicola ME23

Annotation: tRNA pseudouridine(13) synthase TruD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR00094: tRNA pseudouridine synthase, TruD family" amino acids 4 to 338 (335 residues), 247 bits, see alignment E=2.3e-77 PF01142: TruD" amino acids 11 to 167 (157 residues), 134.8 bits, see alignment E=2e-43 amino acids 189 to 337 (149 residues), 62.7 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 71% identical to TRUD_PECCP: tRNA pseudouridine synthase D (truD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K06176, tRNA pseudouridine synthase D [EC: 5.4.99.12] (inferred from 95% identity to ddd:Dda3937_03908)

MetaCyc: 60% identical to tRNA pseudouridine13 synthase (Escherichia coli K-12 substr. MG1655)
RXN-11841 [EC: 5.4.99.27]

Predicted SEED Role

"tRNA pseudouridine 13 synthase (EC 4.2.1.-)" in subsystem tRNA processing (EC 4.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.-, 5.4.99.12

Use Curated BLAST to search for 4.2.1.- or 5.4.99.12 or 5.4.99.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y1Q1 at UniProt or InterPro

Protein Sequence (349 amino acids)

>DZA65_RS18035 tRNA pseudouridine(13) synthase TruD (Dickeya dianthicola ME23)
MVMRESLLWLHGEPAATGVLKASPDDFFVAEDLGFAPDGDGEQVLVRVRKRGCNTTFVAE
ALAKFAGIPARSVSYAGLKDRHAVTEQWFCLHLPGKAEPAWSAFALEGCEILEAQRHRRK
LRIGALRGNHFSLVLREVSDRAEVDARLALIAGEGVPNYFGSQRFGRDGNNLEQARRWAN
DEIRVKDRSKRSFYLSAVRSELFNLMASARLTTYGATQVLTGDALQLTGRSSWFVVKPEE
LADAQSRVAAGELQITAALPGQGEPGVQEQALAFEQQCLEEQALLLSLLTRERVDSARRA
IMLHPQGMRWSWLDNATLELHFWLPAGCFATSVVRELLLPVQQENEWAA