Protein Info for DZA65_RS17990 in Dickeya dianthicola ME23

Annotation: methionine ABC transporter ATP-binding protein MetN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 TIGR02314: D-methionine ABC transporter, ATP-binding protein" amino acids 1 to 343 (343 residues), 642.3 bits, see alignment E=8.3e-198 PF00005: ABC_tran" amino acids 21 to 169 (149 residues), 129.6 bits, see alignment E=1.9e-41 PF13304: AAA_21" amino acids 111 to 200 (90 residues), 27.2 bits, see alignment E=5.6e-10 PF09383: NIL" amino acids 268 to 339 (72 residues), 73.1 bits, see alignment E=2e-24

Best Hits

Swiss-Prot: 84% identical to METN1_SALPA: Methionine import ATP-binding protein MetN 1 (metN1) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02071, D-methionine transport system ATP-binding protein (inferred from 98% identity to ddd:Dda3937_03917)

MetaCyc: 83% identical to L-methionine/D-methionine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
RXN0-4522 [EC: 7.4.2.11]; 7.4.2.11 [EC: 7.4.2.11]; TRANS-RXN-383 [EC: 7.4.2.11]; TRANS-RXN0-510 [EC: 7.4.2.11]; TRANS-RXN0-511 [EC: 7.4.2.11]

Predicted SEED Role

"Methionine ABC transporter ATP-binding protein" in subsystem Methionine Biosynthesis or Methionine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y2A8 at UniProt or InterPro

Protein Sequence (343 amino acids)

>DZA65_RS17990 methionine ABC transporter ATP-binding protein MetN (Dickeya dianthicola ME23)
MIELINITKVFQQKGRAVTALDDVTLRVPAGQIYGVIGASGAGKSTLIRCVNLLERPTQG
KVLIDGKDLMSLSESQLTRTRRQIGMIFQHFNLLSSRTVFGNVALPLELDNTSASEIKQR
VYQLLDLVGLSDKHDAYPANLSGGQKQRVAIARALASNPKVLLCDEATSALDPATTRSIL
ELLKDINRRLGLTILLITHEMDVVKRICDQVAVISDGKLIEQDTVSEVFSHPKTPLAQKF
IQSTLHLDIPNDYQQRLSATPRPGSVPLLRMEFTGQSVDAPLLSEVARTFNVNNNIISAQ
MDYAGGVKFGIMLAEMHGQETDTQAAIVFLQQHHVNIEVLGYV