Protein Info for DZA65_RS17930 in Dickeya dianthicola ME23

Annotation: bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 888 PF13380: CoA_binding_2" amino acids 13 to 130 (118 residues), 84.2 bits, see alignment E=2.9e-27 PF13607: Succ_CoA_lig" amino acids 147 to 281 (135 residues), 153.6 bits, see alignment E=8.3e-49 PF13549: ATP-grasp_5" amino acids 473 to 694 (222 residues), 243.2 bits, see alignment E=6.3e-76 PF13302: Acetyltransf_3" amino acids 728 to 865 (138 residues), 35.9 bits, see alignment E=3.6e-12 PF00583: Acetyltransf_1" amino acids 756 to 865 (110 residues), 47.6 bits, see alignment E=5.8e-16

Best Hits

Swiss-Prot: 76% identical to LYSAC_ECOLI: Peptidyl-lysine N-acetyltransferase PatZ (patZ) from Escherichia coli (strain K12)

KEGG orthology group: K09181, hypothetical protein (inferred from 97% identity to ddd:Dda3937_00888)

MetaCyc: 76% identical to peptidyl-lysine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4B4 at UniProt or InterPro

Protein Sequence (888 amino acids)

>DZA65_RS17930 bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase (Dickeya dianthicola ME23)
MSQRGLEALLRPRSIAVIGASEKPGRAGFLMMRNLLDGGFNGPVLPVTPKYQAVCGVLAY
RDVASLPMTPDLAVICTRADRNLPLLEALGQRGCKTVIVLSAPPSQFAELKNCAARYAVR
LLGPNSLGLLAPWQGLNASFSPVPILKGKLAFISQSAAVSNTILDWAQQRGIGFSYFIAL
GDSLDIDVDDLLDFLARDGKTSAILLHLEHISDARRFLSAARSASRNKPILVIKSGRSRQ
AQQLLHDGQHGLDAAYDAALQRAGLLRVQDTHELFSAVETLSHLRPLRGERLLIVSNGAS
PAAQALDQLIARQGKLATLSEATQQALRAALPDTVAVGNPLDLRDDATPQRYLAALSALL
DSDDYDALLIIHAPSAAAPGTESAESLIQQLQQHPRGKRITLLTNWCGEFSSQEARRLFS
GAGIPTYRTPEGAVIAFMHIVEYRRNQKQLKETPALPSDLTANAAQAHQLIGQALQEGAT
RLDTHEVQPILQVYGLNTLPTWIAGDSTEAVYIAEKIGYPVALKLRSPDIPHKSEIQGVM
LYLQNAQEVQLAAEAMLERVRHTNPQARVHGLLVQGMANRTGALELRIAVEQDAIFGPII
MLGEGGMEWSRETQAAVALPPLNMALARYLIVQALKSGKIRSQSALKPLDIPAFSRLLVQ
VSNLILDCPEISRLDIHPLLASGEEFTLLDVTLHLAPFSGDPQSRLSIRPYPQELEETVR
LKDGASCLFRPILPEDEPLLACFIGKVTREDLYYRYFSEINEFTHEDLANMTQIDYDREM
AFIAVRSGAEGEPEIIGVTRAIADPDNISAEFAVLVRSDLKGLGLGRKLLEKLIHYARAH
GLVRLSGITMPTNQGMVTLAKKLGFAVDVQLEDGIVTLELPLDSSARS