Protein Info for DZA65_RS17910 in Dickeya dianthicola ME23

Annotation: multidrug efflux MFS transporter permease subunit EmrB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 510 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 50 to 71 (22 residues), see Phobius details amino acids 80 to 99 (20 residues), see Phobius details amino acids 106 to 127 (22 residues), see Phobius details amino acids 139 to 160 (22 residues), see Phobius details amino acids 166 to 188 (23 residues), see Phobius details amino acids 200 to 219 (20 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 271 to 291 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 335 to 352 (18 residues), see Phobius details amino acids 367 to 389 (23 residues), see Phobius details amino acids 479 to 497 (19 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 13 to 497 (485 residues), 685.2 bits, see alignment E=2.5e-210 PF07690: MFS_1" amino acids 18 to 413 (396 residues), 188 bits, see alignment E=4.7e-59 PF06609: TRI12" amino acids 24 to 416 (393 residues), 48.6 bits, see alignment E=9.5e-17 PF00083: Sugar_tr" amino acids 31 to 183 (153 residues), 40.3 bits, see alignment E=4e-14

Best Hits

Swiss-Prot: 79% identical to EMRB_ECOLI: Multidrug export protein EmrB (emrB) from Escherichia coli (strain K12)

KEGG orthology group: K03446, MFS transporter, DHA2 family, multidrug resistance protein B (inferred from 98% identity to ddd:Dda3937_00892)

MetaCyc: 79% identical to multidrug efflux pump membrane subunit EmrB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Inner membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CUV9 at UniProt or InterPro

Protein Sequence (510 amino acids)

>DZA65_RS17910 multidrug efflux MFS transporter permease subunit EmrB (Dickeya dianthicola ME23)
MTRKPLEGMTLALMTIALSLATFMQVLDSTIANVAIPTIAGNLGASNSQGTWVITSFGVA
NAISIPITGWLAKRFGEVRLFIWATVLFTLTSWLCGMSTSLEMLIVSRMLQGLVAGPIIP
LSQSLLLNNYPPAKRGIALALWSMTVVVAPIFGPILGGWISDNYHWGWIFFINVPLGLLV
VLITLQTLRGRETKTEIRPIDTIGLILLAAGIGCLQMMLDRGKELDWFNSTEIVALAVIA
VVSLTVLVVWELTDDHPVVDLSLFKMRNFTIGCLCTSLAFMLYFGAIVLLPQLLQVVFGY
TATWAGLASAPVGLMPVILSPLIGRFMHKLDMRRLVTFSFIMYAVCFYWRAYTFEPAMNF
GASAWPQFVQGFAVACFFMPLTTITLSGLPPERMAAASSLSNFARTLAGSIGTSVTTTLW
ERREALHHAQLSEAINPYNPLAQQTYQQLEAMGMSQQQVSSYLAQQVTAQGLIIGANEIF
WLSAGVFVVLIVLVWFAKPPFGGHSAGGAH