Protein Info for DZA65_RS17790 in Dickeya dianthicola ME23
Annotation: amidohydrolase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 71% identical to YAFV_YEREN: Omega-amidase YafV (yafV) from Yersinia enterocolitica
KEGG orthology group: K08590, carbon-nitrogen hydrolase family protein (inferred from 97% identity to dze:Dd1591_0883)MetaCyc: 70% identical to 2-oxoglutaramate amidase (Escherichia coli K-12 substr. MG1655)
Omega-amidase. [EC: 3.5.1.111, 3.5.1.3]
Predicted SEED Role
"Aliphatic amidase AmiE (EC 3.5.1.4)" (EC 3.5.1.4)
MetaCyc Pathways
- L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
- L-methionine salvage cycle III (10/11 steps found)
- L-methionine salvage cycle II (plants) (9/11 steps found)
- S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
- indole-3-acetate biosynthesis III (bacteria) (2/2 steps found)
- acrylonitrile degradation I (1/2 steps found)
- indole-3-acetate biosynthesis IV (bacteria) (1/2 steps found)
- L-arginine degradation X (arginine monooxygenase pathway) (1/3 steps found)
- superpathway of acrylonitrile degradation (1/3 steps found)
- indole-3-acetate biosynthesis II (4/12 steps found)
- nicotine degradation I (pyridine pathway) (5/17 steps found)
KEGG Metabolic Maps
- Alanine and aspartate metabolism
- Arginine and proline metabolism
- Benzoate degradation via CoA ligation
- Biosynthesis of plant hormones
- Cyanoamino acid metabolism
- Glutamate metabolism
- Phenylalanine metabolism
- Styrene degradation
- Tryptophan metabolism
- Urea cycle and metabolism of amino groups
Isozymes
Compare fitness of predicted isozymes for: 3.5.1.4
Use Curated BLAST to search for 3.5.1.111 or 3.5.1.3 or 3.5.1.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A385Y0U9 at UniProt or InterPro
Protein Sequence (255 amino acids)
>DZA65_RS17790 amidohydrolase (Dickeya dianthicola ME23) MSTLKVTLLQQPLVWMNGPANLSHFDGLLSEITDRDLIVLPEMFTTGFAMEAAKSSLEQP VVEAWLKQWAQRNNALVGGSVAVQTGKGAVNRFLLADPQGRVYQYDKRHLFRMAGEHEYY QSGQTREIVEWRGWRILPLICYDLRFPVWSRNRQDYDLALYVANWPAPRAQHWKTLLAAR AIENQAYVAGCNRVGTDGNGHRYQGDSLIIDAQGAILASAPEHQPARLDAELSLETLQSY REAFPAWRDADKFGL