Protein Info for DZA65_RS17780 in Dickeya dianthicola ME23

Annotation: methylthioribulose 1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00596: Aldolase_II
  • amino acids 9 to 195 (187 residues), 154 bits, E=2.1e-49
• TIGR03328: methylthioribulose-1-phosphate dehydratase
  • amino acids 10 to 199 (190 residues), 242.7 bits, E=1.2e-76

Best Hits

Swiss-Prot: 83% identical to MTNB_PECCP: Methylthioribulose-1-phosphate dehydratase (mtnB) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 92% identity to dze:Dd1591_0885)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Sequence Analysis Tools

See A0A3A4CY93 at UniProt or InterPro

Protein Sequence (204 amino acids)

>DZA65_RS17780 methylthioribulose 1-phosphate dehydratase (Dickeya dianthicola ME23)
MSETPQLAALVAACRWIGEKGWCPATGGNMSVRLDERQCLITESGKDKGSLSAQDFLLVD
IATNHVPSGRTPSAETGLHTLLYRLFPAVGAVLHTHSVNATVLSRVEKRAALVLEGYEMQ
KSLSGQRSHLDQVAIPIFDNDQDIPALAARVAARHEAAALRYGFLVRGHGLYCWGNDVKE
ARRHLEGLEFLFQCELQRRLLETQ