Protein Info for DZA65_RS17770 in Dickeya dianthicola ME23

Annotation: acireductone dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 79% identical to MTND2_PECAS: Acireductone dioxygenase 2 (mtnD2) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08967, 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC: 1.13.11.53 1.13.11.54] (inferred from 93% identity to ddd:Dda3937_00923)

MetaCyc: 73% identical to acireductone dioxygenase (Klebsiella oxytoca)
Acireductone dioxygenase (Fe(2+)-requiring). [EC: 1.13.11.54]; Acireductone dioxygenase (Ni(2+)-requiring). [EC: 1.13.11.54, 1.13.11.53]

Predicted SEED Role

"1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC 1.13.11.54)" in subsystem Methionine Salvage (EC 1.13.11.54)

MetaCyc Pathways

L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
L-methionine salvage cycle III (10/11 steps found)
L-methionine salvage cycle II (plants) (9/11 steps found)
S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
3-methylthiopropanoate biosynthesis (1/1 steps found)

KEGG Metabolic Maps

Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.53 or 1.13.11.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0V2 at UniProt or InterPro

Protein Sequence (180 amino acids)

>DZA65_RS17770 acireductone dioxygenase (Dickeya dianthicola ME23)
MSALTIFSDTDARQPVWQSREADAIAQQLSAIHVRFERWQADRDLSATPSAEEVLAAYQH
EVDKLVAEKGYQSWDVVSMRADNPQKAALRTKFLSEHTHAEDEVRFFVEGAGLFCLHVDG
RIFQILCEKNDLLSVPAGIPHWFDMGSAPHFTAIRLFNNPDGWIAHFTGDAIADVYPKLA