Protein Info for DZA65_RS17715 in Dickeya dianthicola ME23

Annotation: esterase FrsA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 PF06500: FrsA-like" amino acids 1 to 416 (416 residues), 671.4 bits, see alignment E=2.2e-206

Best Hits

Swiss-Prot: 76% identical to Y3465_PECAS: UPF0255 protein ECA3465 (ECA3465) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K11750, esterase FrsA [EC: 3.1.-.-] (inferred from 95% identity to ddd:Dda3937_00932)

Predicted SEED Role

"Fermentation/respiration switch protein"

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0Z1 at UniProt or InterPro

Protein Sequence (416 amino acids)

>DZA65_RS17715 esterase FrsA (Dickeya dianthicola ME23)
MVKANLSETLFKPSVKHQETSTLIQRSRNVAGAAAMQSALEGENTGNWYRMINRLLWIWR
GVHPWEIEEVLSRIAASQAARSDDQRLDTVIGYRGGNWIYEWVAQGMRWQQRAGQHAQGE
LAGQYWLNAANLYSIAAYPHLKGDELAEQAQALANRAYEEAAAQLPYELKTLTFPIEGGG
QLTAFLHLPAQESAPFPTVLMCGSLDMLQCDYHRLFQDYLAPAGVAMLTVDMPSVGFSSR
WKLDQDSSFLHQQVLRALPDVPWIDHTRVGAFGFRFGANIAVRLAYLEAGRLRAVACLGP
IVHHLLCDALRQQQVPDMFMDVLASRLGMTYSSDAALLVEMGRYSLKTQGLLGRRCPTPM
FSGYWKDDLISPKEESMLIVNSSQQGKLLSLNFSPVYQTFHLALQQMTDWLRRQLR