Protein Info for DZA65_RS17585 in Dickeya dianthicola ME23

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 PF00005: ABC_tran" amino acids 36 to 195 (160 residues), 93.3 bits, see alignment E=9.1e-30 amino acids 319 to 468 (150 residues), 107.9 bits, see alignment E=3e-34 PF08352: oligo_HPY" amino acids 246 to 277 (32 residues), 23.5 bits, see alignment (E = 2.7e-08) amino acids 520 to 548 (29 residues), 17.8 bits, see alignment (E = 1.6e-06)

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddc:Dd586_3214)

Predicted SEED Role

"Dipeptide transport ATP-binding protein DppD (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4Y9 at UniProt or InterPro

Protein Sequence (558 amino acids)

>DZA65_RS17585 ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MDKHDATLTTTSTPVLAVKDYSLDYTLPDGSHLPVLRDITLHVNRGDVVGLVGESGSGKT
TLGWAIMRWLASNARERTGEIHLGGLNLRTLATDKLHALRGGKLGMIFQDPSASLNPTLT
LGEQVTEVLRRHRRLNAREAQEYAETLLRDVDLKHPALMMQRYPHQVSGGEKQRILIATA
FACQPDCLIFDEPTTALDVISSAQILALFERLREETGVAALYISHDLALVSRVTDSVCVL
EKGRIVEQADARALFSTPQHAYTRRLIAAVPNPAVRLLDETTPSPHPLLTLSDITIQYGH
HRLLDKLLKRQSHQTRAANAVSLTVHEGEILGIVGESGSGKSTLAKAITGLVPFSGELDF
RGYTLPGRSQMDKDYRRRVQMIFQHPDASLNPRMRIGDIIARPLRLYGLPNGETETQAVA
RLLEEVRLPASMASRYPHELSGGQKQRVAIARAFAHPPELVICDEITAALDVSVQATVIE
LLLELRRRYGTAYLFITHDLNLIQQVAHRIAVMYRGDVLEILPGHAMTEQAQHPYTHALL
SAIPTPGALSPAPHSYTE