Protein Info for DZA65_RS17500 in Dickeya dianthicola ME23

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 28 to 51 (24 residues), see Phobius details amino acids 67 to 104 (38 residues), see Phobius details amino acids 113 to 135 (23 residues), see Phobius details amino acids 141 to 164 (24 residues), see Phobius details amino acids 178 to 200 (23 residues), see Phobius details amino acids 230 to 250 (21 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 286 to 308 (23 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 61 to 325 (265 residues), 174.3 bits, see alignment E=1.5e-55

Best Hits

Swiss-Prot: 83% identical to YTFT_ECOLI: Inner membrane ABC transporter permease protein YtfT (ytfT) from Escherichia coli (strain K12)

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 97% identity to ddd:Dda3937_03169)

MetaCyc: 83% identical to galactofuranose ABC transporter putative membrane subunit YtfT (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, permease protein YtfT"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4D552 at UniProt or InterPro

Protein Sequence (345 amino acids)

>DZA65_RS17500 ABC transporter permease (Dickeya dianthicola ME23)
MLRSQLKPGSDKRPFRWPSLRLPQGMPQIAALALVLLVDSLVASHFFQIVVQDGRLFGSP
IDILNRAAPVALLAIGMTLVIATGGIDLSVGAIMAIAGAAAASLTVQGYSLPVVLLAALG
VGMLAGLWNGILVAVLKIQPFVATLILMVAGRGIAQLITAGQIVTFNSPPLAWLGSGALF
YFPTPVIIALLTLILFWLLVRRTALGLFIESVGINIRAAKNAGVSTRTMVTMTYMLSGLC
AAIAGVIVTADIRGADANNAGLWLELDAILAVVIGGGSLMGGRFNLALSVVGALIIQGMN
TGILLSGFPPELNQVVKAIVVLCVLVVQSPRVMTLLRGVGHHDKA