Protein Info for DZA65_RS17490 in Dickeya dianthicola ME23

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13407: Peripla_BP_4
  • amino acids 27 to 260 (234 residues), 152.2 bits, E=2e-48
• PF00532: Peripla_BP_1
  • amino acids 37 to 242 (206 residues), 67.7 bits, E=1.2e-22

Best Hits

Swiss-Prot: 83% identical to YTFQ_ECOLI: ABC transporter periplasmic-binding protein YtfQ (ytfQ) from Escherichia coli (strain K12)

KEGG orthology group: K02058, simple sugar transport system substrate-binding protein (inferred from 98% identity to ddd:Dda3937_03167)

MetaCyc: 83% identical to galactofuranose ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-491 [EC: 7.5.2.9]; 7.5.2.9 [EC: 7.5.2.9]

Predicted SEED Role

"Putative sugar ABC transport system, periplasmic binding protein YtfQ precursor"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.5.2.9

Sequence Analysis Tools

See A0A3A4CZT9 at UniProt or InterPro

Protein Sequence (318 amino acids)

>DZA65_RS17490 ABC transporter substrate-binding protein (Dickeya dianthicola ME23)
MWKRVILASAVCASLSSVALAAPLTVGFSQVGSESGWRAAETTVAKEQAKTRGINLKIAD
AQQKQENQIKAVRSFIAQGVDAIFIAPVVATGWEPVLKEAKEAKIPVILLDRGIDVKDDS
LYLTTVRADNIKEGALIGDWLIKNENGKTCNVVQLEGTVGASVAIDRKKGFEEAIAKTPN
IKIIRSQSGDFTRSGGKQVMESFIKSENNGKNICMVFAHNDDMVIGAIQAIKEAGLKPGK
DILTGSIDGVPDIFRAMLASEANVSVELTPNMAGPAFDALEKYKKDGTLPPKLILTPSTL
FKPDSAQTELDKKKNMGY