Protein Info for DZA65_RS17450 in Dickeya dianthicola ME23

Annotation: recombinase RecA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 TIGR02012: protein RecA" amino acids 6 to 326 (321 residues), 568.5 bits, see alignment E=2.2e-175 PF00154: RecA" amino acids 9 to 270 (262 residues), 475.8 bits, see alignment E=7.4e-147 PF08423: Rad51" amino acids 38 to 228 (191 residues), 37.7 bits, see alignment E=2.8e-13 PF06745: ATPase" amino acids 42 to 217 (176 residues), 30.2 bits, see alignment E=5.9e-11 PF21096: RecA_C" amino acids 273 to 328 (56 residues), 80.7 bits, see alignment E=1.3e-26

Best Hits

Swiss-Prot: 92% identical to RECA_PECAS: Protein RecA (recA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03553, recombination protein RecA (inferred from 98% identity to ddd:Dda3937_03154)

MetaCyc: 87% identical to DNA recombination/repair protein RecA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"RecA protein" in subsystem DNA-replication or DNA repair, bacterial or DNA repair, bacterial RecFOR pathway

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A346D7H9 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DZA65_RS17450 recombinase RecA (Dickeya dianthicola ME23)
MAIDENKQKALAAALGQIEKQFGKGSIMRLGEDRSMDVETISTGSLSLDIALGVGGLPMG
RIVEIYGPESSGKTTLTLQVIAAAQRGGKTCAFIDAEHALDPIYAKKLGVDIDNLLCSQP
DTGEQALEICDALARSGAVDVIIVDSVAALTPKAEIEGEIGDSHMGLAARMMSQAMRKLA
GNLKQSNTLLIFINQIRMKIGVMFGNPETTTGGNALKFYASVRLDIRRIGSIKEGEEVVG
SETRVKVVKNKVAAPFKQAEFQILYGEGINTYGELVDLGVKYKLIEKAGAWYSYNGDKIG
QGKANACKFLKENSAISSELDKKLREMLLHKDNEVVPSVSGESAEYDEEAAGELNDDF