Protein Info for DZA65_RS17335 in Dickeya dianthicola ME23

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 5 to 241 (237 residues), 288.6 bits, see alignment E=1.9e-90 PF13512: TPR_18" amino acids 24 to 167 (144 residues), 240.5 bits, see alignment E=9.8e-76 PF13525: YfiO" amino acids 29 to 236 (208 residues), 282.4 bits, see alignment E=3.5e-88

Best Hits

Swiss-Prot: 82% identical to BAMD_ECOL6: Outer membrane protein assembly factor BamD (bamD) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K05807, putative lipoprotein (inferred from 97% identity to ddc:Dd586_3165)

Predicted SEED Role

"Probable component of the lipoprotein assembly complex (forms a complex with YaeT, YfgL, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C241 at UniProt or InterPro

Protein Sequence (244 amino acids)

>DZA65_RS17335 outer membrane protein assembly factor BamD (Dickeya dianthicola ME23)
MTRMKYLVAAATLSLTLAGCSNSKDAVPDRPPSELYATAQEKLQDGNFKAAITQLEALDN
RYPFGPYAQQVQLDLIYAYYKSAELPLAQASIDRFIRLNPTHPNVDYVLYMRGLTNMAQD
DSALQGFFGVDRSDRDPQYARSAFKAFSQLLQGYPNSQYATDTSKRLAFLKERLAKYELS
VAQYYTKRGAYVAVVNRVEQMLKDYPDTQATRTALPLMENAYRELQLIAQADKVAKIIAA
NPSA