Protein Info for DZA65_RS17230 in Dickeya dianthicola ME23

Annotation: class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 135 TIGR00333: nrdI protein" amino acids 5 to 130 (126 residues), 163.5 bits, see alignment E=1.1e-52 PF07972: Flavodoxin_NdrI" amino acids 5 to 123 (119 residues), 153.8 bits, see alignment E=1.1e-49

Best Hits

Swiss-Prot: 74% identical to NRDI_PECAS: Protein NrdI (nrdI) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K03647, protein involved in ribonucleotide reduction (inferred from 95% identity to ddd:Dda3937_03978)

Predicted SEED Role

"Ribonucleotide reduction protein NrdI" in subsystem Ribonucleotide reduction

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (135 amino acids)

>DZA65_RS17230 class Ib ribonucleoside-diphosphate reductase assembly flavoprotein NrdI (Dickeya dianthicola ME23)
MNPIIYFSSQSENTHRFVCRLGLPAMRIPLQAEAPMPDIASPYILVVPSYGGGSTRGAVP
RQVIHFLNQSSRRALLRGVIAAGNRNFGAAYAIAGDIIAAKCQVPCLYRFELSGTPEDVD
NVRRGVTQFWLQQNS