Protein Info for DZA65_RS17220 in Dickeya dianthicola ME23

Annotation: adenosylmethionine decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 264 TIGR03331: S-adenosylmethionine decarboxylase proenzyme" amino acids 3 to 261 (259 residues), 484.7 bits, see alignment E=3e-150 PF02675: AdoMet_dc" amino acids 44 to 169 (126 residues), 45.4 bits, see alignment E=4.6e-16

Best Hits

Swiss-Prot: 92% identical to SPED_PECCP: S-adenosylmethionine decarboxylase proenzyme (speD) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K01611, S-adenosylmethionine decarboxylase [EC: 4.1.1.50] (inferred from 98% identity to ddc:Dd586_3155)

MetaCyc: 84% identical to S-adenosylmethionine decarboxylase proenzyme (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"S-adenosylmethionine decarboxylase proenzyme (EC 4.1.1.50), prokaryotic class 1A" in subsystem Polyamine Metabolism (EC 4.1.1.50)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.50

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTU1 at UniProt or InterPro

Protein Sequence (264 amino acids)

>DZA65_RS17220 adenosylmethionine decarboxylase (Dickeya dianthicola ME23)
MQKLKLHGFNNLTKSLSFCIYDICYAKTPADRDGYIAYIDEQYNANRLTEILSKTCSIIG
ANVLNIARQDYEPQGASVTILVSEEPMDPRDVDTSEHPGPLPNSVVAHLDKSHICVHTYP
ESHPGGGLCTFRADIEVSTCGVISPLKALNYLIHQLESDIVTIDYRVRGFTRDINGIKHF
IDHKINSIQNFMSDDMKSLYHLMDVNVYQENIFHTKMLLKDFDLKHYLFNVSPEELSPEE
RKRITDLLYREMQEIYYGRNIATV