Protein Info for DZA65_RS17185 in Dickeya dianthicola ME23

Annotation: hypoxanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01203: hypoxanthine phosphoribosyltransferase
  • amino acids 7 to 173 (167 residues), 238 bits, E=2.4e-75
• PF00156: Pribosyltran
  • amino acids 13 to 160 (148 residues), 94.9 bits, E=1.6e-31

Best Hits

Swiss-Prot: 86% identical to HPRT_ECOLI: Hypoxanthine phosphoribosyltransferase (hpt) from Escherichia coli (strain K12)

KEGG orthology group: K00760, hypoxanthine phosphoribosyltransferase [EC: 2.4.2.8] (inferred from 98% identity to ddd:Dda3937_04072)

MetaCyc: 86% identical to hypoxanthine phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Hypoxanthine phosphoribosyltransferase. [EC: 2.4.2.8]; 2.4.2.8 [EC: 2.4.2.8]

Predicted SEED Role

"Hypoxanthine-guanine phosphoribosyltransferase (EC 2.4.2.8)" in subsystem Purine conversions (EC 2.4.2.8)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine and adenosine salvage III (4/4 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• xanthine and xanthosine salvage (2/2 steps found)
• adenine salvage (2/3 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.8

Sequence Analysis Tools

See A0A385Y1Y2 at UniProt or InterPro

Protein Sequence (176 amino acids)

>DZA65_RS17185 hypoxanthine phosphoribosyltransferase (Dickeya dianthicola ME23)
MKHTVDVMISEPEVKARVAELGRQISEHYRNSGNDMVLVGLLRGSFVFMADLCRAIDLSH
EVDFMTASSYGGGMNSSRDVKILKDLDEDIRGKDVLIVEDIIDSGNTLSKVREILQLREP
TSLAICTLLDKPSRREVQVPVEWIGFSIPDEFVVGYGIDYAQRYRHLPFIGKVTPQ