Protein Info for DZA65_RS17070 in Dickeya dianthicola ME23

Annotation: sulfate ABC transporter permease subunit CysT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 61 to 85 (25 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 241 to 262 (22 residues), see Phobius details TIGR02139: sulfate ABC transporter, permease protein CysT" amino acids 8 to 267 (260 residues), 399.7 bits, see alignment E=6.8e-124 TIGR00969: sulfate ABC transporter, permease protein" amino acids 9 to 265 (257 residues), 301.6 bits, see alignment E=5.5e-94 PF00528: BPD_transp_1" amino acids 75 to 269 (195 residues), 78.1 bits, see alignment E=3.8e-26

Best Hits

Swiss-Prot: 51% identical to CYST_SYNY3: Sulfate transport system permease protein CysT (cysT) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: K02046, sulfate transport system permease protein (inferred from 99% identity to ddd:Dda3937_03506)

MetaCyc: 47% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysU (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysT" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CK98 at UniProt or InterPro

Protein Sequence (270 amino acids)

>DZA65_RS17070 sulfate ABC transporter permease subunit CysT (Dickeya dianthicola ME23)
MSRRVSPVIPGFGLTLGFSLTYLGLLVLIPLAAMFLYASQLTLTQFWALITSRQVLFSLQ
LSFGSALTAAFVNGVLGTLLAWVLVRYTFPGRRIIDAMIDMPFALPTAVAGIALTSLYAP
NGLIGSLFPFRIAYTGIGITLALIFVTLPFVVRTLQPVLADFPKEVEEASACLGASPWQT
FRHVLLPAILPAWLTGFALAFARGVGEYGSVVFIAGNIPFKTEILPLLIVSKLDQYDYKG
ATGIGVFMLVVSFIMLLLINLLQRRIQPKL