Protein Info for DZA65_RS17060 in Dickeya dianthicola ME23

Annotation: sulfate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 243 (241 residues), 398.4 bits, see alignment E=5.3e-124 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 133.1 bits, see alignment E=2.1e-42 PF12857: TOBE_3" amino acids 266 to 322 (57 residues), 35.3 bits, see alignment E=1.7e-12

Best Hits

Swiss-Prot: 83% identical to CYSA_PECAS: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 97% identity to ddd:Dda3937_03504)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CTQ8 at UniProt or InterPro

Protein Sequence (330 amino acids)

>DZA65_RS17060 sulfate ABC transporter ATP-binding protein (Dickeya dianthicola ME23)
MSIEVHNVNKQFGQFRALNQINLSIQSGELVALLGPSGCGKTTLLRIIAGLEKPDIGNIV
FHGEDVSGHDVRDRHVGFVFQHYALFRHMTVFDNVAFGLRMKPKAIRPAKRDIEKKVREL
LNMVQLEWLADRYPEQLSGGQRQRIALARALIVEPRILLLDEPFGALDAKVRKELRRWLS
RLHEEINLTSVFVTHDQEEAMEVADRIVLMNKGVIEQIGTPDEVYNHPATEFVYNFLGDS
NRLKLDGHDQTIQFRPHEVTLSKQTQADFQPVVVKDIRPLGALTRLVLKVDGNNELIEAE
IAHDDEVLTGLHRGDVVQFKPKRYNHDWEI