Protein Info for DZA65_RS17055 in Dickeya dianthicola ME23

Annotation: PTS transporter subunit EIIC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 121 to 143 (23 residues), see Phobius details amino acids 164 to 185 (22 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 303 to 354 (52 residues), see Phobius details amino acids 373 to 394 (22 residues), see Phobius details TIGR00410: PTS system, lactose/cellobiose family IIC component" amino acids 3 to 407 (405 residues), 298.1 bits, see alignment E=6.1e-93 PF02378: PTS_EIIC" amino acids 15 to 331 (317 residues), 128.1 bits, see alignment E=2.1e-41

Best Hits

KEGG orthology group: K02761, PTS system, cellobiose-specific IIC component (inferred from 91% identity to dze:Dd1591_1048)

Predicted SEED Role

"PTS system, cellobiose-specific IIC component (EC 2.7.1.69)" in subsystem Beta-Glucoside Metabolism (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CJL5 at UniProt or InterPro

Protein Sequence (418 amino acids)

>DZA65_RS17055 PTS transporter subunit EIIC (Dickeya dianthicola ME23)
MQSIGQNKYLRAVMSGMMLILPVTIMSSFATLLKVFPFSPYQEFLSAHDLGRYFDIPINF
TNNFLAVIATFSIAYTLAKNFDVDGFIAGLIAMISFFIITPYHLGEVGPLGQSFSIPSQW
LGAMGLFSGILVAIISTRIFVFITNKGLIIKMPENVPEFISKSFSALIPGIIILTSFTIL
SAAISMNGWGSAHDIIYKLVQDPLTSLGSGIGSVIIVAVLAQLLWFFGLHGHAITLGVVA
PIWFAMDAQQLAAYSAGIIPPNITGFAFFMTYGVAGDLLPLAFMLAFLAKSQRFKTLGKI
SLPPAVFTIGEPMAYGVPLVMNFALVIPYVLINGIMLAIAYYLTVIGILPRVAGVSTPSG
MPIIISGFMQGSWKIAAFQFVGFFVRFAGWYFFFKIADTIAFKEENDEMEINKNNSNA