Protein Info for DZA65_RS17025 in Dickeya dianthicola ME23

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 320 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF20434: BD-FAE" amino acids 62 to 277 (216 residues), 195.1 bits, see alignment E=3.4e-61 PF00135: COesterase" amino acids 69 to 165 (97 residues), 45.5 bits, see alignment E=1.7e-15 PF07859: Abhydrolase_3" amino acids 76 to 295 (220 residues), 72.4 bits, see alignment E=1.4e-23 PF00326: Peptidase_S9" amino acids 122 to 164 (43 residues), 24.8 bits, see alignment 4.2e-09 amino acids 234 to 318 (85 residues), 34.2 bits, see alignment E=5.7e-12

Best Hits

KEGG orthology group: None (inferred from 92% identity to dze:Dd1591_1052)

Predicted SEED Role

"FIG01201305: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0G4 at UniProt or InterPro

Protein Sequence (320 amino acids)

>DZA65_RS17025 alpha/beta hydrolase (Dickeya dianthicola ME23)
MMKKRALILLSLFSLSCLAEAKSMESKVIDIKMTVPPVRMESDITYSLTYNNMGRPIQLS
MDLLQPYSPKPLPTVLFITGGGFMDAPKSKFIGQRVDMARAGYVVASINYRVVPMVTFPG
MLEDVKTAVRYLRANAEKFGIDPNRIAVMGESAGGYLAALMATTNGMREFDKGEYLDQQS
DVQAAVDLYGLSDLTNVGADFSDEIKDAHKSPAIPEAMLVHGIPWQGGGSILSDLNKAKK
ANPITYISKKTPPFLIMHGDADNVVSPSQTKILHEALVSQGIESTRYVVKGADHAGFLWY
QPEIMDIVIKFLDKNLKDKK