Protein Info for DZA65_RS16945 in Dickeya dianthicola ME23

Annotation: ATP-dependent RNA helicase SrmB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 PF00270: DEAD" amino acids 28 to 198 (171 residues), 155.1 bits, see alignment E=2.2e-49 PF04851: ResIII" amino acids 41 to 191 (151 residues), 33 bits, see alignment E=8.2e-12 PF00271: Helicase_C" amino acids 235 to 343 (109 residues), 100.8 bits, see alignment E=8.1e-33

Best Hits

Swiss-Prot: 84% identical to SRMB_ECOLI: ATP-dependent RNA helicase SrmB (srmB) from Escherichia coli (strain K12)

KEGG orthology group: K05590, ATP-dependent RNA helicase SrmB [EC: 2.7.7.-] (inferred from 96% identity to ddd:Dda3937_03841)

MetaCyc: 84% identical to ATP-dependent RNA helicase SrmB (Escherichia coli K-12 substr. MG1655)
5.6.2.e [EC: 5.6.2.e]

Predicted SEED Role

"ATP-dependent RNA helicase SrmB" in subsystem ATP-dependent RNA helicases, bacterial

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.-

Use Curated BLAST to search for 2.7.7.- or 5.6.2.e

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y4U6 at UniProt or InterPro

Protein Sequence (450 amino acids)

>DZA65_RS16945 ATP-dependent RNA helicase SrmB (Dickeya dianthicola ME23)
MTATNFSEFDLDDSLLDALRDMGFSRPTAIQAEAISPAMEGRDVLGSAPTGTGKTAAYLL
PVLQHLLDFPRKKSGPPRILILTPTRELAMQVADQARALAAHTHLDIATITGGVAYMNHA
EVFSENQDVVVATTGRLLQYIKEENFDCRAVETLILDEADRMLDLGFAQDIEHIAGETRW
RKQTMLFSATLEGDAIQDFADRLLNDPIKVEADPSRRERKKILQWYYRADDVQHKTALLS
HLLKQPDVTRSIVFVRKRERVHELVDWLRSVGIESCYLEGEMVQAKRNEAIKRLSEGRVN
VLVATDVAARGLDIQDVSHVFNFDLPRTSDVYLHRIGRTGRAGRKGCAISLVEAHDYLLL
EKIGRYLNEPLKARVVDELRPATRAPSPKANGKPSKKVLAKRSELKQKEKEKQKAKVKVR
HRDSKNIGKRRQPSATASAEPQKGKPADNS