Protein Info for DZA65_RS16940 in Dickeya dianthicola ME23

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 PF06325: PrmA" amino acids 45 to 124 (80 residues), 22 bits, see alignment E=2.5e-08 PF13847: Methyltransf_31" amino acids 46 to 179 (134 residues), 30.8 bits, see alignment E=5.7e-11 PF05175: MTS" amino acids 46 to 171 (126 residues), 46.2 bits, see alignment E=1e-15 PF13649: Methyltransf_25" amino acids 50 to 123 (74 residues), 29.9 bits, see alignment E=1.9e-10

Best Hits

Swiss-Prot: 76% identical to TRMN6_DICC1: tRNA1(Val) (adenine(37)-N6)-methyltransferase (Dd1591_1060) from Dickeya chrysanthemi (strain Ech1591)

KEGG orthology group: None (inferred from 90% identity to ddd:Dda3937_03842)

MetaCyc: 53% identical to tRNA m6A37 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-12480 [EC: 2.1.1.223]

Predicted SEED Role

"tRNA (adenine37-N(6))-methyltransferase TrmN6 (EC 2.1.1.223)" (EC 2.1.1.223)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.223

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3W3 at UniProt or InterPro

Protein Sequence (247 amino acids)

>DZA65_RS16940 methyltransferase (Dickeya dianthicola ME23)
MTSLQHTPALRAGGFTFKQFFVAHDRCAMKVGTDGVLLGAWAPLREESRILDIGCGSGLM
ALMLAQRSGGRIPVDGVELDAAAGEQAADNAVASPWADNIRIHPTDILAYACTGVSRYSL
IVSNPPYFTPGVDCASVQRAQARYTATLTHEALLDCASQLLTPDGRFCVVLPVQAADNFL
KLAQQLSWHVDAWVDVADNSARPVNRVLLSLGRQPATLDRTSLIIRDDNRQYSAQFQALT
RDFYLFM