Protein Info for DZA65_RS16870 in Dickeya dianthicola ME23

Annotation: cyclic-guanylate-specific phosphodiesterase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 54% identical to PDEH_ECOLI: Cyclic di-GMP phosphodiesterase PdeH (pdeH) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to ddd:Dda3937_03856)

MetaCyc: 54% identical to cyclic di-GMP phosphodiesterase PdeH (Escherichia coli K-12 substr. MG1655)
Cyclic-guanylate-specific phosphodiesterase. [EC: 3.1.4.52]

Predicted SEED Role

"GGDEF/EAL domain protein YhjH"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CZZ7 at UniProt or InterPro

Protein Sequence (263 amino acids)

>DZA65_RS16870 cyclic-guanylate-specific phosphodiesterase (Dickeya dianthicola ME23)
MAEHIVQQNSHFNQPGSEASITGEVQFADADYWRSCHRWYRFQPIYRTSGRLMGIELLTA
VFHPSVPHKFLSPEHYFARLDVEQRLNIVIEQLQLLSQWHERFVQDGLRASVNIDGLTLL
ALQENRKAKTLLTTMPWLRFELVESLAVLPHDTLARLPEAGQLWLDDFGCGVANFSSLSP
AKYDCIKIARELFIMLLKSNEGRQLFPSLVTLIATYCNDVVIEGVETEEEWEIVRQSNAS
AAQGYFLSRPQPFENLDDLRSEL