Protein Info for DZA65_RS16840 in Dickeya dianthicola ME23

Annotation: tRNA adenosine(34) deaminase TadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF14437: MafB19-deam" amino acids 5 to 129 (125 residues), 103.9 bits, see alignment E=6.6e-34 PF00383: dCMP_cyt_deam_1" amino acids 6 to 104 (99 residues), 105.8 bits, see alignment E=9.7e-35

Best Hits

Swiss-Prot: 74% identical to TADA_SALTY: tRNA-specific adenosine deaminase (tadA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 92% identity to ddd:Dda3937_03381)

MetaCyc: 75% identical to tRNA adenosine34 deaminase (Escherichia coli K-12 substr. MG1655)
3.5.4.-

Predicted SEED Role

"tRNA-specific adenosine-34 deaminase (EC 3.5.4.-)" in subsystem tRNA processing (EC 3.5.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.4.-

Use Curated BLAST to search for 3.5.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y3V3 at UniProt or InterPro

Protein Sequence (167 amino acids)

>DZA65_RS16840 tRNA adenosine(34) deaminase TadA (Dickeya dianthicola ME23)
MINTMDDEFWMRHALTLAQRAWDEGEVPVGAVLVQGDKIIGEGWNRPISRHDPTAHAEIM
ALQQGGQALQNYRLLDTTLYITLEPCVMCAGAMIHSRINRLVYGAADAKTGAAGSLVDIL
RHPGMNHHIAITDGILADECADLLSRFFRMRRQQQRETRAAEQDSSD