Protein Info for DZA65_RS16835 in Dickeya dianthicola ME23

Annotation: membrane-bound lytic murein transglycosylase MltF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 signal peptide" amino acids 1 to 6 (6 residues), see Phobius details amino acids 25 to 25 (1 residues), see Phobius details transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 26 to 26 (1 residues), see Phobius details PF00497: SBP_bac_3" amino acids 51 to 267 (217 residues), 74.4 bits, see alignment E=7.4e-25 PF01464: SLT" amino acids 296 to 403 (108 residues), 86.3 bits, see alignment E=1.2e-28

Best Hits

Swiss-Prot: 80% identical to MLTF_PECAS: Membrane-bound lytic murein transglycosylase F (mltF) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03380)

MetaCyc: 62% identical to membrane-bound lytic murein transglycosylase F (Escherichia coli K-12 substr. MG1655)
4.2.2.f [EC: 4.2.2.f]

Predicted SEED Role

"Transglycosylase, Slt family"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.2.f

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0R7 at UniProt or InterPro

Protein Sequence (485 amino acids)

>DZA65_RS16835 membrane-bound lytic murein transglycosylase MltF (Dickeya dianthicola ME23)
MKRLTINYVFIGVIALLLTLALWPNIPWRSHQDVQLRQILSRGELRISTVTSPLTYTLSN
GSPTGLDYELAKRFADYLGVRLVVSVRQNVDDLFSDLDNDNADLLAAGLIYNRERLSRFQ
AGPSYYSVSQQLVYRMGTARPPSLDKLQGKLTVLSGSAHAATLRDFKVGTYPQLSWEVAT
DLSELDLLKQVAEGKLDYTIADSINIGLMQRIHPQLAVSFDLSDEEPVTWYMRQNHDDSL
SAALLDFFSQMMEDGTLARLEEKYLGHVGEFDYVDTTTFLSAIDSILPGLRPLFEKHARE
IDWKLLAAISYQESHWNPLATSPTGVRGLMMLTRNTAESLDVANRLNPEESIRGGARYLN
QMMQQVPATIPTDERIWFALAAYNMGYAHMMDARKLTEKQKGNPDSWADVKIRLPMLSQK
RYYAQTANGYARGQEAYNYVENIRRYMVSLVGYLSEKESRALQQQLAVSAYPAVPPEQLT
ANPSR