Protein Info for DZA65_RS16825 in Dickeya dianthicola ME23

Annotation: HAMP domain-containing histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 178 to 201 (24 residues), see Phobius details PF00512: HisKA" amino acids 253 to 317 (65 residues), 54.7 bits, see alignment E=8.7e-19 PF02518: HATPase_c" amino acids 366 to 474 (109 residues), 72.2 bits, see alignment E=5e-24

Best Hits

Swiss-Prot: 70% identical to GLRK_ECOLI: Sensor histidine kinase GlrK (glrK) from Escherichia coli (strain K12)

KEGG orthology group: K07711, two-component system, NtrC family, sensor histidine kinase YfhK [EC: 2.7.13.3] (inferred from 97% identity to ddd:Dda3937_03378)

MetaCyc: 70% identical to histidine kinase GlrK (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0I5 at UniProt or InterPro

Protein Sequence (477 amino acids)

>DZA65_RS16825 HAMP domain-containing histidine kinase (Dickeya dianthicola ME23)
MISLKRWRFFPRSLRQLVVMAFLLVLLPLLVLAYQAYESLDHLSEQAAGINNTTLADARR
SEAMTSTAISMERSYRQFCVLGDQTLSQLYQNQRKQYSQMLDAHASILPDPSYYQNLRQY
LTQLTDIRCQNNGPAAASAAVLDNFSRTNAQMVQATRDVIFSRGQQLQQDIAERGRFFGW
QALVLFLVSVLLVMLFTRMIIGPVKGVERMINRLGEGRSLGRIARFRGPTEIRSLAQRII
WLSERLSWLEAQRHEFLRHLSHELKTPLASLREGAALLADEVVGTLTADQKEVVAILDNS
SRHLQQLIEQLLDYNRKLADAPAGLEQVDIDDIVNMVVSAHSLPARGKLMQTHIDLGAKA
CRAETTLLMRVVDNLYSNAVHYGQESGNIWIRSRQVERRVQIDVANSGTPIPESDKSMIF
EPFYQGSHQRKGAVKGSGLGLSIAQDCIRRMQGELNLVTVDYADVCFRIELPLNTEN