Protein Info for DZA65_RS16710 in Dickeya dianthicola ME23

Annotation: iron-sulfur cluster assembly protein IscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF01521: Fe-S_biosyn" amino acids 1 to 103 (103 residues), 87.2 bits, see alignment E=4.3e-29 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 3 to 107 (105 residues), 123.2 bits, see alignment E=5e-40 TIGR02011: iron-sulfur cluster assembly protein IscA" amino acids 3 to 107 (105 residues), 192.5 bits, see alignment E=1.3e-61

Best Hits

Swiss-Prot: 91% identical to ISCA_YERE8: Iron-binding protein IscA (iscA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 98% identity to ddc:Dd586_3068)

MetaCyc: 81% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Iron binding protein IscA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CNZ1 at UniProt or InterPro

Protein Sequence (107 amino acids)

>DZA65_RS16710 iron-sulfur cluster assembly protein IscA (Dickeya dianthicola ME23)
MSISLSDSAAQRVNAFMVNRGKGVGLRLGVRTSGCSGMAYVLEFVDELNTDDVVFEDKGV
KVIIDGKSLVYLDGTELDFVKEGLNEGFKFNNPNVSSECGCGESFNV