Protein Info for DZA65_RS16695 in Dickeya dianthicola ME23
Annotation: ISC system 2Fe-2S type ferredoxin
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 93% identical to FER_ECO57: 2Fe-2S ferredoxin (fdx) from Escherichia coli O157:H7
KEGG orthology group: K04755, ferredoxin, 2Fe-2S (inferred from 93% identity to ecj:JW2509)MetaCyc: 93% identical to reduced ferredoxin (Escherichia coli K-12 substr. MG1655)
Predicted SEED Role
"Ferredoxin, 2Fe-2S" in subsystem Soluble cytochromes and functionally related electron carriers
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A3A4CXF1 at UniProt or InterPro
Protein Sequence (111 amino acids)
>DZA65_RS16695 ISC system 2Fe-2S type ferredoxin (Dickeya dianthicola ME23) MPKIVFLPHQDLCPEGAVLEANSGETILDVALRNGIEIEHACEKSCACTTCHCIVREGFD SLAESTEDEDDMLDKAWGLEPESRLGCQARVADEDLVVEIPRYTINHAREH