Protein Info for DZA65_RS16680 in Dickeya dianthicola ME23

Annotation: enhanced serine sensitivity protein SseB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF07179: SseB" amino acids 9 to 126 (118 residues), 91.7 bits, see alignment E=4e-30 PF14581: SseB_C" amino acids 143 to 250 (108 residues), 122.1 bits, see alignment E=1.2e-39

Best Hits

Swiss-Prot: 59% identical to SSEB_SHIFL: Protein SseB (sseB) from Shigella flexneri

KEGG orthology group: None (inferred from 95% identity to ddd:Dda3937_03698)

Predicted SEED Role

"Protein SseB"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0A9 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DZA65_RS16680 enhanced serine sensitivity protein SseB (Dickeya dianthicola ME23)
MEFAPHNRLEEVLTLAASEPAHRPEFFSELLEATVYVLGHSEEDDASGESSLQAGNGLQL
QHWEKPDGHSAIPFFSSLEALQLAVTDEQAFLALPVRTLFDLTRGATLFLNPKLPYGKEF
LPQEIEHLLSGEGSSLVQQHILDGGTELKIGIPAEMPAQMIDSLTQLFSKHRNVKRAFLA
QIQEPDDDQPHLLIGLDADGDDLEALIQAAGSVATDTQPDDRPIDLCLVSNEQAGISHFL
IRHTTPFYERKWGSFLREFKGSGQA