Protein Info for DZA65_RS16640 in Dickeya dianthicola ME23

Annotation: YfgM family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 206 transmembrane" amino acids 24 to 42 (19 residues), see Phobius details PF09976: TPR_21" amino acids 15 to 205 (191 residues), 201.3 bits, see alignment E=3.3e-63 PF13432: TPR_16" amino acids 92 to 151 (60 residues), 26.3 bits, see alignment E=2.1e-09 PF14559: TPR_19" amino acids 100 to 153 (54 residues), 28.7 bits, see alignment E=3.5e-10

Best Hits

Swiss-Prot: 56% identical to YFGM_ECOLI: UPF0070 protein YfgM (yfgM) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 98% identity to ddd:Dda3937_03707)

Predicted SEED Role

"Mlr7403 protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CQH8 at UniProt or InterPro

Protein Sequence (206 amino acids)

>DZA65_RS16640 YfgM family protein (Dickeya dianthicola ME23)
MEVYSTENEQVEAIRRFFIENGKALAIGVVLGIGALVGWRFWQNHQESNAMAASVAYQQV
TESLSAGTPEGVAGAEKFVTGDHGNYGALASLALAHQFVEKNDIAKAEQQLRQALSQTKD
GDLQALINLRLARVLLQQKKPDDALKTLDAIKLEGWAAMVADVRGDVLASKGDNQGARDA
YNKGMAAKPSQGLQSLLRIKLNNLPS