Protein Info for DZA65_RS16470 in Dickeya dianthicola ME23

Annotation: terminase small subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details PF03592: Terminase_2" amino acids 43 to 196 (154 residues), 104.8 bits, see alignment E=3.2e-34

Best Hits

KEGG orthology group: K07474, phage terminase small subunit (inferred from 68% identity to ect:ECIAI39_2685)

Predicted SEED Role

"Phage terminase small subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385Y0C1 at UniProt or InterPro

Protein Sequence (218 amino acids)

>DZA65_RS16470 terminase small subunit (Dickeya dianthicola ME23)
MAADYGGFVLRVTITKMVTILVVISMVANPKRKSTQYRPLSAVQEAYCQEYIKSPENQTQ
AAINAGYSHKTAAKFASQNMRDDRVQKRIAELMEERNKRLRVSADYVLLRLVEIDQMDVI
DILDEEGGLKPVSQWPKVWRTSLSAMDINRIRMAGKDGEDDIESTLQKVKWPDKVKNLEL
IGKHVDVMAFKERVEVSGTVTIADRMAAARKRVQDGGK